uenzae: a randomised double-blindefficacy study. Lancet.2006; 367:740-748.
48- Reddy, M. S. , Bernstein, J. M. , Murphy, T. F. , Faden, H. (1996) Bindingbetween outer membrane proteins of nontypeable Haemophilus influenzae andhuman nasopharyngeal mucin. Infect. Immun. 64.1447-1449.
49- Read,T. D. ,S. W. Satola,et al. (1998). Copy number of pilus gene clusters in Haemophilus Influenzae and variation in the hifE pilin gene. Infection and Immunity 66(4):1622-1631.
50- Roche R. and Maxon.E,1995,Phenotype variation in Haemophilus influenza:The Interrelationship of colony opacity,conjugate and rotavirus vaccines in national immunization schedules,Health Econ. 9:19-35Bishai,Howard,Winkelstein,and Smith,1994,Characterization and Virulence Analysis of Catalas Mutants of Haemophilus influenza,Infection and Immunity,P. 48554860.
51- San Martin,B. ,L. Lapierre,et al. (2008). Characterization of antibiotic resistance genes linked to class 1 and 2 integrons in strains of Salmonella spp. isolated from swine. Canadian journal of microbiology 54(7):569-576.
52- Sanders J D And el,1993, Reconstitution of a porin-deficient mutant of Haemophilus influenzae type b with a porin gene from nontypeable H. influenzae. 1993,nfect Immun,v. 61(9); PMC281101. Available from: http://www.ncbi. nlm. nih. gov/pmc/articles/PMC281101[1392/5]
53- Schouls L, van der Heide H, Witteveen S, Zomer B, Burger M,Schot C. Two variants among Haemophilus influenzae serotypeb strains with distinct bcs4, hcsA and hcsB genesdisplay differences in expression of the polysaccharide capsule.BMC Microbiol.2008;8:35.
54- Sharifat Salmani A, Siadat S. D, Ahmadi H, Nejati M, Norouzian D, TabaraieB, Abbasi M, Karbasian M, Mohabati Mobarez A, Shapouri R. Optimization ofBrucella abortus S99 lipopolysaccharide extraction by phenol and Butanolmethods. Res J Bio Sci 3(6):576-580, 2008.
55- Sikkema, D. J. and T. F. Murphy, Molecular analysis of the P2 porin protein of nontypeable Haemophilus influenzae.Infect Immun, 1992. 60(12): p. 5204-11
56- Snow,J. B. (2002). Progress in the prevention of otitis media through immunization. Otology &Neurotology 23(1):1-2.
57- Stellwagen,E. and N. C. Stellwagen(2002). The free solution mobility of DNA in Tris-acetate EDTA buffers of different concentrations,with and without added Nacl. Electrophoresis 23(12):19351941.
58- Sukupolvi-Petty S،Grass S،St Geme I. The Haemophilus influenzae Type b hcsAand hcsB gene products facilitate transport of capsularpolysaccharide across the outer membrane and areessential for virulence. J Bacteriol.2006;188: 3870-3877
59- Swords WE, Chance DL, Cohn LA, Shao J, Apicella MA, Smith AL. AcylationofthelipooligosaccharideofHaemophilusinfluenzae andcolonization: an htrb mutation diminishes thecolonization of human airway epithelial cells. Infect Immun. 2002;70: 4661-4668
60- Swords WE, Ketterer MR, Shao J, CampbellCA, Weiser JN, Apicella MA.Bindingofthenon-typeableHaemophilusinfluenzaelipooligosaccharide to the PAF receptor initiates host cell signalling. Cell Microbiol.2001; 3: 525-538
61- Tibor, A. 1995.Pyrogen test.In: United states pharmacopoeia 23rd,Revision, U. S. pharmacopeial Convention.Inc. , Rockville, M. D. , D. 1718
62- Van Ham SM, van Alphen L, Mooi FR, van Putten JP. Contribution of themajorandminorsubunitstofimbria-mediatedadherenceofHaemophilus influenzae to human epithelial cells and erythrocytes.Infect Immun. 1995;63: 4883-4889
63- Varela et al.Membrane Protein as Novel Targets for Vaccine Production in Haemophilus influenzae and Neisseria meningitidis Vaccines Vaccin 2012, 3:6 Available from: http://dx.doi. org/10. 4172/2157-7560. 1000152,[1392/12].
64- Winkelstein JA،Moxon ER.The role of complement in thehost’s defense against Haemophilus influenzae.J Infect Dis. 1992; 165 (Suppl. 1):S62.
65- Winn WS, Allen W, Janda E. Koneman G,Procop P. Koneman’s color atlas and textbook of diagnostic Microbiology. 6th edition,Philadelphia, Lippincott Williams and Wilkins, 2006.
66- the Basis of Nanotechnology Development at TRIUMF: How Application Begin”،canada’s Nanotecnology Laratory For particle And nuclear Physics Available from: http:/www.triumf. info/public/repository/ Hb/Hb20309. pdf”
67- http:/www.Com.Msu.edu / reusch / virtual. Tekd / Spectrpy / nmr / nmr). Ntm.

Abstract
Haemophilus influenzae is a Gram negative and specific human pathogen that causes acute bacterial meningitis , septicemia , epiglotitis , bacterimia , otitis media . the goal of this study is one of the conserved proteins in this bacterium and designing of a domestic vaccine against it. ProteinP2 (38-40 KDa ) comprises more than 50 percent of all the proteins in outer membrane of Haemophilus and is expressesed by non-capsulated strains of H.influenzae type b.
This protein is indictaed as a proper candidate for vaccine to non-capsulated Haemophilus influenzae .in this study , epidemiology of ompP2 gene was surveyed using clinical samples isolated from 30 patients . the bacteria were cultured in chocolate agar mediaand Biochemical tests performed for them. After DNA purification , PCR method was performed for samples . all the samples were positive for ompP2 gene . after sequencing of 6 samples and comparison of ompP2 gene in all samples with domestic strains that exist in Gene Bank , similarities and differences due to nucleotide deletion , addition or translocation were defined by MEGA 4 software.
PCR products were digested by Alu1 and EcoR1 for defining of polymorphism patterns in given gene. Cutting patterns in 21 samples (98%-99%) were similar to domestic samples and 9 (91%-98%) of them were distinct. our results are indicated that ompP2 gene organization is similar to distinct strains of Haemophilus ifluenzae recorded in Gene Bank (accessionno: J3359.1, M93268.1, M93269.1, M93270.1) and polymorphism has occurred in cutting region by Alu1 enzyme. Thus this protein can be considered as a potential vaccine of Haemophilus in future studies.

Key word: Haemophilus influenzae, vaccine, ompP2 gene

پيوست ها

“پيوست الف”
Display Settings:
* GenBank
Format
* Summary
* GenBank
* GenBank (full)
* FASTA
* FASTA (text)
* Graphics
* ASN.1a
* Revision History
* Accession List
* GI List
Apply
Send:
* Complete Record
* Coding Sequences
* Gene Features
Choose Destination
* File
* Clipboard
* Collections
* Analysis Tool
* Format
Create File
Add to Clipboard
Add to Collections
Choose Sequence Analysis Tool
* BLAST
* PrimerBLAST
Submit
Download features.
* Format
Create File
Download gene features.
* Format
Create File

Haemophilus influenzae outer membrane protein P2(ompP2) gene, complete cds
GenBank: M93269.1
FASTAGraphics

Go to:
* Features
* Sequence
LOCUS HEAOMPPB 1137 bp DNA linear BCT 26-APR-1993
DEFINITION Haemophilus influenzae outer membrane protein P2 (OMPP2) gene,
complete cds.
ACCESSION M93269
VERSION M93269.1 GI:148964
KEYWORDS OMPP2 gene; outer membrane protein P2.
SOURCE Haemophilus influenzae 2019
ORGANISM Haemophilus influenzae 2019
Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales;
Pasteurellaceae; Haemophilus.
REFERENCE 1 (bases 1 to 1137)
AUTHORS Sikkema,D.J. and Murphy,T.F.
TITLE Molecular analysis of the P2 porin protein of nontypeable
Haemophilus influenzae
JOURNAL Infect. Immun. 60 (12), 5204-5211 (1992)
PUBMED 1280627
FEATURES Location/Qualifiers
source 1..1137
/organism=”Haemophilus influenzae 2019″
/mol_type=”genomic DNA”
/strain=”2019″
/db_xref=”taxon:1232659″
gene 1..1137
/gene=”OMPP2″
CDS 1..1137
/gene=”OMPP2″
/note=”precursor”
/codon_start=1
/transl_table=11
/product=”outer membrane protein”
/protein_id=”AAA24996.1″
/db_xref=”GI:148965″
/translation=”MKKTLAALIVVAFAASAANAAVVYNNEGTNVELGGRLSIIAEQSNSTIKDQKQQHGALRNQSSRFHIKATHNFGDGFYAQGYLETRLVSAQSGTESDNFGHIITKYAYVTLGNFAKGEVKLGRAKTIADGIISAEDKEYGVLNNSKYIPTNGNTVGYTFKGIDGLVLGANYLLAQQRHKYTAAAAAAAAAGGARAVAGEVYPQKISNGVQVGAKYDANNIIAGIAYGRTNYREDITITPADKLGKKQQVNGALSTLGYRFSDLGLLVSLDSGYAKTKNYKAKHEKSYFVSPGFQYELMEDTNVYGNFKYERNSVDQGEKEREQAVLFGIDHKLHKQVLTYIEGAYSRTRTTTVGSKTNASKVKTEKEKSVGVGLRVYF”
sig_peptide 1..60
/gene=”OMPP2″
mat_peptide 61..1134
/gene=”OMPP2″
/product=”outer membrane protein P2″
ORIGIN
1 atgaaaaaaa cacttgcagc attaatcgtt gttgcattcg cagcttcagc agcaaacgca
61 gctgttgttt ataacaacga agggactaac gtagaattag gtggtcgttt aagcattatc
121 gcagaacaaa gtaatagcac tataaaggat caaaaacagc aacacggtgc attacgcaat
181 caaagttcac gtttccacat taaagcaacg cataacttcg gtgatggttt ctatgcacaa
241 ggttatttag aaactcgttt agtttcagct caatctggaa ccgagtcaga taacttcggt
301 catattataa ccaaatatgc ttatgtcact ttaggaaatt tcgcaaaggg tgaagtaaaa
361 cttggtcgtg cgaaaactat tgctgatggc ataataagcg cagaagataa agaatatggt
421 gttctcaaca atagcaaata tattcctact aatggtaata ccgttggcta cacttttaaa
481 ggtatcgatg gtttagtatt aggtgctaat tatttattag cacaacagcg tcataagtat
541 actgctgctg ctgctgctgc tgctgctgct ggtggtgctc gtgctgttgc aggagaagtt
601 tatccacaaa aaatcagcaa tggcgttcag gttggtgcaa aatatgatgc aaacaacatt
661 attgcaggta ttgcttatgg tcgtacaaat tatagagaag

دسته بندی : No category

دیدگاهتان را بنویسید